PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr028512.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family GRAS
Protein Properties Length: 786aa    MW: 84521.2 Da    PI: 6.5518
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr028512.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS419.43.1e-1284137722374
         GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaN 99 
                   +lLl+cAeavs++++ +a+++L ++sel++p g++ qR+aayf eA++arl++s+ ++y++lp s+ +++++++ ++a+++f+ +sP++kfsh+taN
  Pbr028512.1 413 LTLLLKCAEAVSADNFDEATKILLEISELSTPFGTSAQRVAAYFSEAMSARLVSSCLGIYASLPRSSVPTTHTQKMVSAFQVFNGISPFIKFSHFTAN 510
                  579*****************************************************************999*************************** PP

         GRAS 100 qaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvk 197
                  qaI ea+e+e+rvHi+D+di+qGlQWp L++ LasRp+gpp +R+Tg+g     s e+le+tg+rL++fA++lg+pfef + va+++++l++e+L+v+
  Pbr028512.1 511 QAIQEAFEREDRVHIVDLDIMQGLQWPGLFHILASRPGGPPYVRLTGLGT----SMEALEATGKRLSDFADKLGLPFEFFP-VAEKVANLDPERLNVS 603
                  **************************************************....***************************.7*************** PP

         GRAS 198 pgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreiv 295
                  ++Ea+aV++    h+l+d ++s +s    +L+l+++l Pkvv+vveq+++h ++sFl rf+ea++yysalfdsl a++++eseer++vE++ll+rei+
  Pbr028512.1 604 KREAVAVHWLQ--HSLYDVTGSDSS----TLWLLQRLAPKVVTVVEQDLSH-AGSFLGRFVEAIHYYSALFDSLGASYGEESEERHVVEQQLLSREIR 694
                  **********9..999999999888....**********************.899******************************************* PP

         GRAS 296 nvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                  nv+a  g +r  + + +++Wre++++ GF+ ++l  +aa+qa+lll +++sdgy++ e++g+l lgWkd  L+++SaWr
  Pbr028512.1 695 NVLAVGGPSRSGEVK-FHNWREKFQQTGFRGISLAGNAANQASLLLGMFPSDGYTLVEDNGTLKLGWKDLCLLTASAWR 772
                  *********888776.**************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098562.276386752IPR005202Transcription factor GRAS
PfamPF035141.1E-125413772IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008356Biological Processasymmetric cell division
GO:0009630Biological Processgravitropism
GO:0009956Biological Processradial pattern formation
GO:0048366Biological Processleaf development
GO:0051457Biological Processmaintenance of protein location in nucleus
GO:0090610Biological Processbundle sheath cell fate specification
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 786 aa     Download sequence    Send to blast
MNNTTTNSNS SSVEQQPPKM VRKRMASEIE VQTTLTSRTA GSDYFRLSRR GIINNSPPVQ  60
PVSQNPNASK VNSSMFYPNH STMLLPVPSS TNLAALTSPG GAFLSPTSPS PSPSSAAAAG  120
TWGPIDPLSF HRPPPVQPTT TTQTTTTPAV CGFSGLPLFP PEKTTPLNTS ITATTPSSVS  180
MEDGSSAATA WIDGIIKDLV HSSTNVSIPQ LIHNVREIIF PCNPSLAALL EYRLRSISEP  240
LPPPPLPLPV PSFNPTPIPD MRRRQQGGPG PGALKLNLDS GAIHDVAIFN PSTVENNDLY  300
LQSWSGGAGG GGVGLSLPQP NPTAAPITCN QTNPHHQSPS FNQAIHQTQD KQLENSSSSS  360
PAAESTTPTA APAPTTTAAT APPEPTTSAV SLLREKKEEI RQQKRDEEGL HLLTLLLKCA  420
EAVSADNFDE ATKILLEISE LSTPFGTSAQ RVAAYFSEAM SARLVSSCLG IYASLPRSSV  480
PTTHTQKMVS AFQVFNGISP FIKFSHFTAN QAIQEAFERE DRVHIVDLDI MQGLQWPGLF  540
HILASRPGGP PYVRLTGLGT SMEALEATGK RLSDFADKLG LPFEFFPVAE KVANLDPERL  600
NVSKREAVAV HWLQHSLYDV TGSDSSTLWL LQRLAPKVVT VVEQDLSHAG SFLGRFVEAI  660
HYYSALFDSL GASYGEESEE RHVVEQQLLS REIRNVLAVG GPSRSGEVKF HNWREKFQQT  720
GFRGISLAGN AANQASLLLG MFPSDGYTLV EDNGTLKLGW KDLCLLTASA WRPPFHAAAN  780
PNLHY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-484127724375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009337846.10.0PREDICTED: protein SCARECROW 2-like
SwissprotQ2Z2E90.0SCR_IPONI; Protein SCARECROW
SwissprotQ9M3840.0SCR_ARATH; Protein SCARECROW
TrEMBLM5WLC90.0M5WLC9_PRUPE; Uncharacterized protein
STRINGPOPTR_0006s11500.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20683489
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54220.10.0GRAS family protein